PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG021682t1
Common NameTCM_021682
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Trihelix
Protein Properties Length: 267aa    MW: 31806.1 Da    PI: 8.8159
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG021682t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.74.1e-2527109186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       +W+ qe+++ + +r e+++++ ++k++k lWe +s +mre+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  Thecc1EG021682t1  27 QWSIQETKEFLMIRAELDRSFMETKRNKMLWEVISTRMREKGYNRSAEQCKCKWKNLVTRYKGCETMEADA---MRQQFPFYNELQ 109
                       7********************************************************************95...55689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.35E-212691No hitNo description
PfamPF138371.3E-2027111No hitNo description
PROSITE profilePS500907.4572884IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MEGRHHHPHP PQQQTMGVNV DVDRFPQWSI QETKEFLMIR AELDRSFMET KRNKMLWEVI  60
STRMREKGYN RSAEQCKCKW KNLVTRYKGC ETMEADAMRQ QFPFYNELQA IFSSRMQSIL  120
WTDEGGVTGS KKKAVQLSSE EDEDMEESEL DKGSGIRKKK KGKTGIGGGA SGSSNNIKEI  180
LEDFMRQQMQ MEMQWREAFE ARENERRLKE MEWRQTMQAL ENERIMMDRR WREKEEQRRV  240
REEARAEKRD ALITALLNKL RREEHM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1224107386DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1277680.0JN127768.1 Theobroma cacao clone TCC_BC011L18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026681.10.0Homeodomain-like superfamily protein
SwissprotQ9SDW02e-71TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A061ERD10.0A0A061ERD1_THECC; Homeodomain-like superfamily protein
STRINGPOPTR_0006s10240.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-51Trihelix family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]